OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels

Amir Jalali; Frank Bosmans; Mehriar Amininasab; Elke Clynen; Eva Cuypers; Abbas Zaremirakabadi; Mohammad Nabi Sarbolouki; Liliane Schoofs; Hossein Vatanpour; Jan Tytgat

doi:10.1016/j.febslet.2005.06.052

OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na⁺ channels

Amir Jalali, Frank Bosmans, Mehriar Amininasab, Elke Clynen, Eva Cuypers, Abbas Zaremirakabadi, Mohammad Nabi Sarbolouki, Liliane Schoofs, Hossein Vatanpour, Jan Tytgat

Research output: Contribution to journal › Article › peer-review

41 Scopus citations

Abstract

In this study, we isolated and pharmacologically characterized the first α-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na⁺ channels expressed in Xenopus laevis oocytes (Na_v1.2/β₁, Na _v1.5/β₁, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC ₅₀ = 80 ± 14 nM) while Na_v1.2/β₁ still was not affected at concentrations up to 5 μM. Na_v1.5/ β₁ was influenced at micromolar concentrations.

Original language	English (US)
Pages (from-to)	4181-4186
Number of pages	6
Journal	FEBS Letters
Volume	579
Issue number	19
DOIs	https://doi.org/10.1016/j.febslet.2005.06.052
State	Published - Aug 1 2005
Externally published	Yes

Keywords

Iranian scorpion Odonthobuthus doriae
Voltage-gated Na channel
α-like toxin

ASJC Scopus subject areas

Biophysics
Structural Biology
Biochemistry
Molecular Biology
Genetics
Cell Biology

Access to Document

10.1016/j.febslet.2005.06.052

Cite this

@article{04a4596f72c84777a444f3a5327db285,

title = "OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels",

abstract = "In this study, we isolated and pharmacologically characterized the first α-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Nav1.2/β1, Na v1.5/β1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC 50 = 80 ± 14 nM) while Nav1.2/β1 still was not affected at concentrations up to 5 μM. Nav1.5/ β1 was influenced at micromolar concentrations.",

keywords = "Iranian scorpion Odonthobuthus doriae, Voltage-gated Na channel, α-like toxin",

author = "Amir Jalali and Frank Bosmans and Mehriar Amininasab and Elke Clynen and Eva Cuypers and Abbas Zaremirakabadi and Sarbolouki, {Mohammad Nabi} and Liliane Schoofs and Hossein Vatanpour and Jan Tytgat",

year = "2005",

month = aug,

day = "1",

doi = "10.1016/j.febslet.2005.06.052",

language = "English (US)",

volume = "579",

pages = "4181--4186",

journal = "FEBS Letters",

issn = "0014-5793",

publisher = "Elsevier",

number = "19",

}

TY - JOUR

T1 - OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels

AU - Jalali, Amir

AU - Bosmans, Frank

AU - Amininasab, Mehriar

AU - Clynen, Elke

AU - Cuypers, Eva

AU - Zaremirakabadi, Abbas

AU - Sarbolouki, Mohammad Nabi

AU - Schoofs, Liliane

AU - Vatanpour, Hossein

AU - Tytgat, Jan

PY - 2005/8/1

Y1 - 2005/8/1

N2 - In this study, we isolated and pharmacologically characterized the first α-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Nav1.2/β1, Na v1.5/β1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC 50 = 80 ± 14 nM) while Nav1.2/β1 still was not affected at concentrations up to 5 μM. Nav1.5/ β1 was influenced at micromolar concentrations.

AB - In this study, we isolated and pharmacologically characterized the first α-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Nav1.2/β1, Na v1.5/β1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC 50 = 80 ± 14 nM) while Nav1.2/β1 still was not affected at concentrations up to 5 μM. Nav1.5/ β1 was influenced at micromolar concentrations.

KW - Iranian scorpion Odonthobuthus doriae

KW - Voltage-gated Na channel

KW - α-like toxin

UR - http://www.scopus.com/inward/record.url?scp=22544480319&partnerID=8YFLogxK

UR - http://www.scopus.com/inward/citedby.url?scp=22544480319&partnerID=8YFLogxK

U2 - 10.1016/j.febslet.2005.06.052

DO - 10.1016/j.febslet.2005.06.052

M3 - Article

C2 - 16038905

AN - SCOPUS:22544480319

SN - 0014-5793

VL - 579

SP - 4181

EP - 4186

JO - FEBS Letters

JF - FEBS Letters

IS - 19

ER -